Bedding Sets & Collections - Page 345

Manufacturer: Green Living Group Brand: Chezmoi Collection Model: Upland-Duvet-Coffee Color: Aqua Blue/Sage Green/Coffee Brown

Duvet cover sets are designed to keep you updated and fashionable in the most convenient and inexpensive way. Our comforter sets are a tremendous blend of bold and vibrant colors. They can transform a room from bleak to bright and cheery in a matter of minutes. Our comforter set will have your bedroom decorated affordably and with style. Turn your home into a haven with our beautiful comforter/duvet collection. Our duvet set come in many sizes, including king, queen, full and even California king sets. We've included everything you need to make over your bedroom such as comforter, pillow shams and bed skirts. Comforter sets are comfortable, durable and beautiful. Our comforter sets are designed for year around comfort. Sweet dreams await you in our bedding sets shop.

Manufacturer: Green Living Group INC. Brand: Chezmoi Collection Model: Lex Color: Navy Blue

Comforter sets are designed to keep you updated and fashionable in the most convenient and inexpensive way. Our comforter sets are a tremendous blend of bold and vibrant colors. They can transform a room from bleak to bright and cheery in a matter of minutes. Our comforter set will have your bedroom decorated affordably and with style. Turn your home into a haven with our beautiful comforter collection. Our comforters come in many sizes, including king comforters, queen comforters and even California King comforter sets. We've included everything you need to make over your bedroom such as comforter, pillow shams and bed skirts. Comforter sets are comfortable, durable and beautiful. Our comforter sets are designed for year around comfort.

Manufacturer: Revman International Brand: Eddie Bauer Model: 215784 Color: full/queen

The large scale of this plaid offers a bold and updated casual look for your bedroom. A handsome neutral palette of putty and chrome is accented with beet red and the small-scale check in putty and chrome on the duvet reverse is the perfect complement to the larger plaid face. Printed on soft cotton, this bedding set is comfortable and inviting. Coordinate with our Eddie Bauer sheet sets, blankets and decorative pillows to complete the look for your room.

Manufacturer: Ikea Brand: IKEA Model: 3892301 Color: white and gray

Beautiful white and Gray Striped Pattern Duvet Cover and Pillowcases King Size Ikea Nyponros Includes: 1 King duvet cover and 2 King pillowcases. 152 thread count. Yarn-dyed; the yarn is dyed before weaving; gives the bedlinens a soft feel. Bedlinen densely woven from fine yarn; soft and durable quality. Duvet cover and pillowcase with decorative, fabric-covered buttons keeps the comforter and pillow in place. Product dimensions Duvet cover length: 86 " Duvet cover width: 102 " Pillowcase length: 20 " Pillowcase width: 36 " Duvet cover length: 218 cm Duvet cover width: 259 cm Pillowcase length: 51 cm Pillowcase width: 91 cm Care instructions Machine wash ,hot 140°F (60°C). Do not bleach. Tumble dry, normal. Iron, high temperature. Do not dryclean. Product description 100 % cotton

Manufacturer: Pegasus Home Fashions Brand: Pegasus Home Fashions Model: 4500NICO-4FQ

Pegasus Home Fashions Vintage Collection Full/Queen Size Reversible Quilt/Sham Set-The Vintage Quilt Collection is a classic quilt design that has an amazing charm and feel that goes with almost any bedroom motif. We've combined two distinctive patterns together that complement each other wonderfully making this quilt reversible. The Vintage Collection Quilt is constructed from 100-percent printed polyester microfiber to create a quilt that has a beautiful sheen and is smooth to the touch. This quilt is meant for year round use. Filled with 200GSM 50-Percent polyester/50-percent cotton makes the quilt heavy enough for winter use but yet light enough for summer. Intricate stitching across the whole quilt and shams creates a unique pattern, adds durability and insures the batting will not shift or bunch. Fabric bound scalloped borders add visual interest and character. Full/queen size quilt measures 84-by-86 inches and includes two shams. Machine wash cold, tumble-dry low.

Manufacturer: Sweet Home Collection Brand: Sweet Home Collection Model: COMF-3PC-BLKGRY-FQ Color: Black/Gray

100percentpolyestermicrofibercomforterfeaturesdualreversiblecolors.includescomforterandmatchingpillowshams.comespackagedinanattractivevinylbagwithzipper.ifyouwanttoachieveadrapedlook,wesuggestordering1sizelargerthanyourbedsize.twinsizeincludesonly1pillowsham.

Manufacturer: Crystals Shop Brand: CrystalsShop Model: 93-PP7272619 Color: White

Please leave message to tell us the size which you want, if not, we will send it randomly. Thanks! ============================ Queen Size Quilt cover : 200cm * 230cm * 1 Bed sheet : 250 cm * 250 cm * 1 Pillowcase : 48 cm * 74 cm * 2 King Size Quilt cover : 200cm * 230cm * 1 Bed sheet : 250 cm * 270 cm * 1 Pillowcase : 48 cm * 74 cm * 2 ============================  

Manufacturer: Chic Home Brand: Chic Home Model: QS2602-AN Color: Yellow

A luxury yellow Quilt set ensemble that reverses into a contrasting colors to create 2 different looks and color combinations. Make the room fun and bright this summer with this soft embroidery detail on the Quilt and shams set. Flip and change as your mood changes and play with that is what we should all be doing on our bed after a long day is to have a nice fun atmosphere to enjoy and be cozy so have fun.. composed of luxury grade super soft microfiber polyester fabric. Set includes twin: 1 piece Boho inspired print Quilt: 66x90 Inch, 1 piece shams: 20x26+2 Inch. Care instructions: machine wash cold on gentle cycle. Do not bleach or dry clean. Tumble dry low. Light iron as needed.

Manufacturer: Green Living Group INC. Brand: Chezmoi Collection Model: Mosaic-Duvet-White-Queen Color: Solid Black/Brown/White

Chezmoi Collection 7 Pieces soft micro suede patchwork duvet cover set . To keep your duvet from shifting inside its cover while you sleep, secure it in place at the corners with the interior corner ties. Fabric Content: 100 % Polyester.

Manufacturer: Greenland Home Fashions Brand: Greenland Home Model: GL-1603JMST Color: Red

Colorful feathers billow on the breeze in the Dream Catcher quilt set. Let the Western wind summon the peaceful spirits of slumber. Face print features red, crocous, blue, gold, teal and gray pinions on an ivory ground. Wind-swirl quilting throughout. Reverses to a coordinate feather print on teal blue for two looks in one! Oversized for better coverage on today's deeper mattresses. Prewashed and preshrunk. Machine quilted with fabric bound edges for durability and surface interest. Quilt set comes with quilt and two pillow shams (one sham per Twin set). Dimensions: Twin set includes one 68x88" quilt plus one 20x26" pillow sham, Full/Queen set includes one 90x90" quilt plus two 20x26" pillow shams, King set includes one 105x95" quilt plus two 20x36" pillow shams. Dimensions +/- 2". Machine Wash. 100% Microfiber polyester face; 100% cotton back; Fill is 70% cotton/30% polyester.